PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00075251001
Common NameGSBRNA2T00075251001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 295aa    MW: 33754.2 Da    PI: 8.0175
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00075251001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.97.2e-26166214351
              G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                          r+rW+++LH+rFv+a++ +GGs++AtPk+i+++mkv+gLt++++kSHLQ
  GSBRNA2T00075251001 166 RRRWSEDLHRRFVDALQMIGGSQVATPKQIKDIMKVDGLTNDEIKSHLQ 214
                          99*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.816161221IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-21162229IPR009057Homeodomain-like
SuperFamilySSF466891.08E-11162215IPR009057Homeodomain-like
TIGRFAMsTIGR015577.9E-22166214IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MSLDLNLYSL AKPLSQFLND VSKIRDNHSK LFEIDEYVGK LEEERKKIDV FKRELPICML  60
LMNEAIERLK EEASSVKLEI DNKKNWMNSA QLWISNTNSQ LPSTNGEEDR CVTQTCSNNN  120
NSNQGGAILS FNVPPRPPPL SLRTPILTDY SSRIEQSHPI QKKELRRRWS EDLHRRFVDA  180
LQMIGGSQVA TPKQIKDIMK VDGLTNDEIK SHLQCEMINL LQKYRMHIHK HPAKILTASD  240
QHGLSRSDSP QGPLVDRGLF SNNGHSSEEE EKSDGRSWKS ESRRKRQGLL DLEL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00075251001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013746538.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A078HW620.0A0A078HW62_BRANA; BnaA03g53680D protein
STRINGBra017795.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-105G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]